Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
Domain d7ldje1: 7ldj E:6-126 [403514] Other proteins in same PDB: d7ldja1, d7ldja2, d7ldjb1, d7ldjb2, d7ldjc1, d7ldjc2, d7ldjd_, d7ldje2, d7ldjf2, d7ldjg2, d7ldjh2 automated match to d1bzqk_ complexed with man, nag, pg4 |
PDB Entry: 7ldj (more details), 2.36 Å
SCOPe Domain Sequences for d7ldje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ldje1 b.1.1.1 (E:6-126) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqpggslrlscavsgftldyyaigwfrqapgkeregvscisssggntkyadsvk grftasrdnakntfylqmnslkpedtavyycaaiaatyysgsyyfqcphdgmdywgkgtq vtvss
Timeline for d7ldje1: