Lineage for d7ldje1 (7ldj E:6-126)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356783Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
  8. 2356847Domain d7ldje1: 7ldj E:6-126 [403514]
    Other proteins in same PDB: d7ldja1, d7ldja2, d7ldjb1, d7ldjb2, d7ldjc1, d7ldjc2, d7ldjd_, d7ldje2, d7ldjf2, d7ldjg2, d7ldjh2
    automated match to d1bzqk_
    complexed with man, nag, pg4

Details for d7ldje1

PDB Entry: 7ldj (more details), 2.36 Å

PDB Description: sars-cov-2 receptor binding domain in complex with wnb-2
PDB Compounds: (E:) Nanobody 2

SCOPe Domain Sequences for d7ldje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ldje1 b.1.1.1 (E:6-126) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscavsgftldyyaigwfrqapgkeregvscisssggntkyadsvk
grftasrdnakntfylqmnslkpedtavyycaaiaatyysgsyyfqcphdgmdywgkgtq
vtvss

SCOPe Domain Coordinates for d7ldje1:

Click to download the PDB-style file with coordinates for d7ldje1.
(The format of our PDB-style files is described here.)

Timeline for d7ldje1: