SCOP 1.57: Domain d1kbcb_: 1kbc B:

Lineage for d1kbcb_ (1kbc B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)

6. Protein Neutrophil collagenase (MMP-8) [55532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55533] (13 PDB entries)

8. Domain d1kbcb_: 1kbc B: [40351]

Details for d1kbcb_

PDB Entry: 1kbc, 1.81 Å

PDB Description: procarboxypeptidase ternary complex

SCOP Domain Sequences for d1kbcb_:

Sequence; same for both SEQRES and ATOM records:

>d1kbcb_ d.92.1.11 (B:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
fghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

Timeline for d1kbcb_:

• d1kbcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1kbcb_ appears in SCOP 1.59
  
• d1kbcb_ appears in the current release, SCOPe 2.08