Lineage for d7ls5a_ (7ls5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2594900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2595067Domain d7ls5a_: 7ls5 A: [403508]
    Other proteins in same PDB: d7ls51_, d7ls52_, d7ls5d2, d7ls5h_, d7ls5i_, d7ls5j_, d7ls5k_, d7ls5l_, d7ls5m_, d7ls5n_, d7ls5v_, d7ls5w_, d7ls5x_, d7ls5y_, d7ls5z_
    automated match to d4cr2a_

Details for d7ls5a_

PDB Entry: 7ls5 (more details), 2.74 Å

PDB Description: cryo-em structure of the pre3-1 20s proteasome core particle
PDB Compounds: (A:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d7ls5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ls5a_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d7ls5a_:

Click to download the PDB-style file with coordinates for d7ls5a_.
(The format of our PDB-style files is described here.)

Timeline for d7ls5a_: