Lineage for d7ls6c_ (7ls6 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600377Domain d7ls6c_: 7ls6 C: [403478]
    Other proteins in same PDB: d7ls6a_, d7ls6b_, d7ls6f_, d7ls6j_, d7ls6k_
    automated match to d4cr2c_
    mutant

Details for d7ls6c_

PDB Entry: 7ls6 (more details), 3.17 Å

PDB Description: cryo-em structure of pre-15s proteasome core particle assembly intermediate purified from pre3-1 proteasome mutant (g34d)
PDB Compounds: (C:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d7ls6c_:

Sequence, based on SEQRES records: (download)

>d7ls6c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtstek
lyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqh
gglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmk
vddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgi

Sequence, based on observed residues (ATOM records): (download)

>d7ls6c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtstek
lyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqh
gglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmk
vddaielalktlskttdssaltydrlefatirkevyqkifkpqeikdilvktgi

SCOPe Domain Coordinates for d7ls6c_:

Click to download the PDB-style file with coordinates for d7ls6c_.
(The format of our PDB-style files is described here.)

Timeline for d7ls6c_: