SCOPe 2.08: Domain d1fbla2: 1fbl A:100-271

Lineage for d1fbla2 (1fbl A:100-271)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [55531] (1 PDB entry)

8. Domain d1fbla2: 1fbl A:100-271 [40347]
   Other proteins in same PDB: d1fbla1
   complexed with ca, hta, zn

Details for d1fbla2

PDB Entry: 1fbl, 2.5 Å

PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller

PDB Compounds: (A:) fibroblast (interstitial) collagenase (mmp-1)

SCOPe Domain Sequences for d1fbla2:

Sequence; same for both SEQRES and ATOM records:

>d1fbla2 d.92.1.11 (A:100-271) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa) [TaxId: 9823]}
fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsg

Timeline for d1fbla2:

• d1fbla2 first appeared (with stable ids) in SCOP 1.55, called d1fbl_2
  
• d1fbla2 appears in SCOPe 2.07