SCOPe 2.07: Domain d7lk3a1: 7lk3 A:1-117

Lineage for d7lk3a1 (7lk3 A:1-117)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187279] (32 PDB entries)

8. Domain d7lk3a1: 7lk3 A:1-117 [403454]
   Other proteins in same PDB: d7lk3a2, d7lk3b2
   automated match to d1v49a_
   complexed with edo

Details for d7lk3a1

PDB Entry: 7lk3, 1.9 Å

PDB Description: crystal structure of untwinned human gabarapl2

PDB Compounds: (A:) gamma-aminobutyric acid receptor-associated protein-like 2

SCOPe Domain Sequences for d7lk3a1:

Sequence; same for both SEQRES and ATOM records:

>d7lk3a1 d.15.1.3 (A:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf

Timeline for d7lk3a1:

• d7lk3a1 is new in SCOPe 2.07-stable
  
• d7lk3a1 appears in the current release, SCOPe 2.08