SCOPe 2.07: Domain d7ljxa_: 7ljx A:

Lineage for d7ljxa_ (7ljx A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (17 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [322473] (5 PDB entries)

8. Domain d7ljxa_: 7ljx A: [403450]
   automated match to d5c0za_
   complexed with fc6, hec; mutant

Details for d7ljxa_

PDB Entry: 7ljx, 1.31 Å

PDB Description: oxidized rat cytochrome c mutant (k53q)

PDB Compounds: (A:) Cytochrome c, somatic

SCOPe Domain Sequences for d7ljxa_:

Sequence; same for both SEQRES and ATOM records:

>d7ljxa_ a.3.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqaagfsytdanqnkgitwg
edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne

Timeline for d7ljxa_:

• d7ljxa_ is new in SCOPe 2.07-stable
  
• d7ljxa_ appears in the current release, SCOPe 2.08