SCOPe 2.07: Domain d7kp0a2: 7kp0 A:184-278

Lineage for d7kp0a2 (7kp0 A:184-278)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7kp0a2: 7kp0 A:184-278 [403425]
   Other proteins in same PDB: d7kp0a1, d7kp0a3, d7kp0b1, d7kp0b2
   automated match to d5c9ja2
   complexed with edo, wua

Details for d7kp0a2

PDB Entry: 7kp0, 2.4 Å

PDB Description: cd1a-42:1 sm binary complex

PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d7kp0a2:

Sequence; same for both SEQRES and ATOM records:

>d7kp0a2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywe

Timeline for d7kp0a2:

• d7kp0a2 is new in SCOPe 2.07-stable
  
• d7kp0a2 appears in the current release, SCOPe 2.08