SCOPe 2.07: Domain d7kksb2: 7kks B:84-198

Lineage for d7kksb2 (7kks B:84-198)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)

8. Domain d7kksb2: 7kks B:84-198 [403418]
   Other proteins in same PDB: d7kksa1, d7kksb1
   automated match to d1n0ja2
   complexed with mn3

Details for d7kksb2

PDB Entry: 7kks, 2.2 Å

PDB Description: neutron structure of oxidized human mnsod

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d7kksb2:

Sequence; same for both SEQRES and ATOM records:

>d7kksb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d7kksb2:

• d7kksb2 is new in SCOPe 2.07-stable
  
• d7kksb2 appears in the current release, SCOPe 2.08