SCOPe 2.07: Domain d7kksb1: 7kks B:0-83

Lineage for d7kksb1 (7kks B:0-83)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries)

8. Domain d7kksb1: 7kks B:0-83 [403417]
   Other proteins in same PDB: d7kksa2, d7kksb2
   automated match to d1n0ja1
   complexed with mn3

Details for d7kksb1

PDB Entry: 7kks, 2.2 Å

PDB Description: neutron structure of oxidized human mnsod

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d7kksb1:

Sequence; same for both SEQRES and ATOM records:

>d7kksb1 a.2.11.1 (B:0-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia
lqpalkfnggghinhsifwtnlsp

Timeline for d7kksb1:

• d7kksb1 is new in SCOPe 2.07-stable
  
• d7kksb1 appears in the current release, SCOPe 2.08