Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins) |
Protein S-adenosylmethionine synthetase [55975] (3 species) synonym: methionine adenosyltransferase, MAT |
Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (8 PDB entries) Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395 MAT2A |
Domain d7kdba2: 7kdb A:126-251 [403407] automated match to d2p02a2 complexed with cl, edo, gol, sam, trs, wbs |
PDB Entry: 7kdb (more details), 1.24 Å
SCOPe Domain Sequences for d7kdba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kdba2 d.130.1.1 (A:126-251) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} needigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvt vqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlq psgrfv
Timeline for d7kdba2: