Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190140] (37 species) not a true protein |
Species Escherichia coli [TaxId:562] [189978] (4 PDB entries) |
Domain d7jtrc_: 7jtr C: [403362] Other proteins in same PDB: d7jtrb1, d7jtrb2, d7jtrb3, d7jtrd1, d7jtrd2, d7jtrd3, d7jtrf1, d7jtrf2, d7jtrf3, d7jtrh1, d7jtrh2, d7jtrh3 automated match to d1jvya_ complexed with cl |
PDB Entry: 7jtr (more details), 2.5 Å
SCOPe Domain Sequences for d7jtrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jtrc_ c.94.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelvkdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea lkdaqtrit
Timeline for d7jtrc_: