Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries) |
Domain d7klbb1: 7klb B:0-83 [403358] Other proteins in same PDB: d7klba2, d7klbb2 automated match to d1n0ja1 complexed with k, mn, po4 |
PDB Entry: 7klb (more details), 2.16 Å
SCOPe Domain Sequences for d7klbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7klbb1 a.2.11.1 (B:0-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia lqpalkfnggghinhsifwtnlsp
Timeline for d7klbb1: