Lineage for d7ki6l1 (7ki6 L:1-92)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370482Domain d7ki6l1: 7ki6 L:1-92 [403353]
    automated match to d4odhl1
    complexed with nag

Details for d7ki6l1

PDB Entry: 7ki6 (more details), 2.8 Å

PDB Description: structure of the hev f glycoprotein in complex with the 1f5 neutralizing antibody
PDB Compounds: (L:) 1F5 Fab light chain

SCOPe Domain Sequences for d7ki6l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ki6l1 b.1.1.0 (L:1-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaslgeaitltcsasssvsymhwyqqksgtspklliystsnlasgvpsr
fsgsgsgtfysltissveaedaadyychqwys

SCOPe Domain Coordinates for d7ki6l1:

Click to download the PDB-style file with coordinates for d7ki6l1.
(The format of our PDB-style files is described here.)

Timeline for d7ki6l1: