Lineage for d7kcfa3 (7kcf A:252-395)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976294Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2976295Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2976345Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (8 PDB entries)
    Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395
    MAT2A
  8. 2976354Domain d7kcfa3: 7kcf A:252-395 [403343]
    automated match to d2p02a3
    complexed with edo, gol, j4a, sam

Details for d7kcfa3

PDB Entry: 7kcf (more details), 1.1 Å

PDB Description: crystal structure of human methionine adenosyltransferase 2a (mat2a) in complex with sam and allosteric inhibitor agi-24512
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d7kcfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kcfa3 d.130.1.1 (A:252-395) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc
rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy
qrtaayghfgrdsfpwevpkklky

SCOPe Domain Coordinates for d7kcfa3:

Click to download the PDB-style file with coordinates for d7kcfa3.
(The format of our PDB-style files is described here.)

Timeline for d7kcfa3: