SCOPe 2.07: Domain d7jxsc_: 7jxs C:

Lineage for d7jxsc_ (7jxs C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
   topologically similar to one subunit in the interferon-gamma intertwined dimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (12 PDB entries)

8. Domain d7jxsc_: 7jxs C: [403329]
   automated match to d1upha_
   complexed with 12p, act, p6g, so4; mutant

Details for d7jxsc_

PDB Entry: 7jxs, 2.35 Å

PDB Description: crystal structure human immunodeficiency virus-1 matrix protein mutant q63r crystal form 2

PDB Compounds: (C:) matrix protein

SCOPe Domain Sequences for d7jxsc_:

Sequence; same for both SEQRES and ATOM records:

>d7jxsc_ a.61.1.1 (C:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgrlqp
slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaq

Timeline for d7jxsc_:

• d7jxsc_ is new in SCOPe 2.07-stable
  
• d7jxsc_ appears in the current release, SCOPe 2.08