Lineage for d7d7kb1 (7d7k B:4-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933522Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (35 PDB entries)
  8. 2933527Domain d7d7kb1: 7d7k B:4-61 [403285]
    Other proteins in same PDB: d7d7ka2, d7d7kb2
    automated match to d4m0wa1
    complexed with cff, edo, so4, zn

Details for d7d7kb1

PDB Entry: 7d7k (more details), 1.9 Å

PDB Description: the crystal structure of sars-cov-2 papain-like protease in apo form
PDB Compounds: (B:) non-structural protein 3

SCOPe Domain Sequences for d7d7kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d7kb1 d.15.1.0 (B:4-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd

SCOPe Domain Coordinates for d7d7kb1:

Click to download the PDB-style file with coordinates for d7d7kb1.
(The format of our PDB-style files is described here.)

Timeline for d7d7kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7d7kb2