Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (35 PDB entries) |
Domain d7d7kb1: 7d7k B:4-61 [403285] Other proteins in same PDB: d7d7ka2, d7d7kb2 automated match to d4m0wa1 complexed with cff, edo, so4, zn |
PDB Entry: 7d7k (more details), 1.9 Å
SCOPe Domain Sequences for d7d7kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d7kb1 d.15.1.0 (B:4-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} tikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd
Timeline for d7d7kb1: