Lineage for d1htdb_ (1htd B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205462Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2205467Protein Snake venom metalloprotease [55520] (7 species)
  7. 2205491Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 2205497Domain d1htdb_: 1htd B: [40327]
    complexed with ca, zn

Details for d1htdb_

PDB Entry: 1htd (more details), 2.1 Å

PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (ht-d)
PDB Compounds: (B:) atrolysin c

SCOPe Domain Sequences for d1htdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htdb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp

SCOPe Domain Coordinates for d1htdb_:

Click to download the PDB-style file with coordinates for d1htdb_.
(The format of our PDB-style files is described here.)

Timeline for d1htdb_: