![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.9: Reprolysin-like [55519] (3 proteins) Pfam PF01421 |
![]() | Protein Snake venom metalloprotease [55520] (7 species) |
![]() | Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries) |
![]() | Domain d1htda_: 1htd A: [40326] complexed with ca, zn |
PDB Entry: 1htd (more details), 2.1 Å
SCOPe Domain Sequences for d1htda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htda_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds mhyyerflkqykpqcilnkp
Timeline for d1htda_: