Lineage for d1htda_ (1htd A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.9: Hemorrhagin [55519] (1 protein) Protein Snake venom metalloprotease [55520] (4 species) Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries) 
Domain d1htda_: 1htd A: [40326]
Details for d1htda_
PDB Entry: 1htd (more details), 2.1 Å
PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (ht-d)
SCOP Domain Sequences for d1htda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htda_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp
SCOP Domain Coordinates for d1htda_:
Click to download the PDB-style file with coordinates for d1htda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1htda_:
- d1htda_ appears in SCOP 1.57
- d1htda_ appears in the current release, SCOPe 2.08
View in 3D
