SCOPe 2.07: Domain d7egfp1: 7egf P:161-256

Lineage for d7egfp1 (7egf P:161-256)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226065] (2 PDB entries)

8. Domain d7egfp1: 7egf P:161-256 [403257]
   Other proteins in same PDB: d7egfk_
   automated match to d1jfic1

Details for d7egfp1

PDB Entry: 7egf, 3.16 Å

PDB Description: tfiid lobe a subcomplex

PDB Compounds: (P:) tata-box-binding protein

SCOPe Domain Sequences for d7egfp1:

Sequence; same for both SEQRES and ATOM records:

>d7egfp1 d.129.1.0 (P:161-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgkmv
ctgakseeqsrlaarkyarvvqklgfpakfldfkiq

Timeline for d7egfp1:

• d7egfp1 is new in SCOPe 2.07-stable
  
• d7egfp1 appears in the current release, SCOPe 2.08