SCOPe 2.08: Domain d7edra3: 7edr A:209-312

Lineage for d7edra3 (7edr A:209-312)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [403239] (1 PDB entry)

8. Domain d7edra3: 7edr A:209-312 [403240]
   Other proteins in same PDB: d7edra1, d7edra2, d7edrb1, d7edrb2
   automated match to d2zpya2

Details for d7edra3

PDB Entry: 7edr, 2.53 Å

PDB Description: the crystal structure of the ferm and c-terminal domain complex of drosophila merlin

PDB Compounds: (A:) Moesin/ezrin/radixin homolog 2

SCOPe Domain Sequences for d7edra3:

Sequence; same for both SEQRES and ATOM records:

>d7edra3 b.55.1.0 (A:209-312) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dmygvnyfpitnknktklwlgvtsvglniyderdkltpkttfqwneirhvsfddkkftir
lvdakvsnfifysqdlhinkmildlckgnhdlymrrrkpdtmei

Timeline for d7edra3:

• d7edra3 first appeared in SCOPe 2.07