Lineage for d1dtha_ (1dth A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570750Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2570755Protein Snake venom metalloprotease [55520] (7 species)
  7. 2570779Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 2570782Domain d1dtha_: 1dth A: [40324]
    complexed with bat, ca, zn

Details for d1dtha_

PDB Entry: 1dth (more details), 2 Å

PDB Description: metalloprotease
PDB Compounds: (A:) atrolysin c

SCOPe Domain Sequences for d1dtha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtha_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp

SCOPe Domain Coordinates for d1dtha_:

Click to download the PDB-style file with coordinates for d1dtha_.
(The format of our PDB-style files is described here.)

Timeline for d1dtha_: