![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.9: Reprolysin-like [55519] (3 proteins) Pfam PF01421 |
![]() | Protein Snake venom metalloprotease [55520] (7 species) |
![]() | Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries) |
![]() | Domain d3aiga_: 3aig A: [40321] complexed with 0zc, ca, so4, zn |
PDB Entry: 3aig (more details), 2.8 Å
SCOPe Domain Sequences for d3aiga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aiga_ d.92.1.9 (A:) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId: 8729]} nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd smgyyqkflnqykpqcilnkp
Timeline for d3aiga_: