Lineage for d7d7la2 (7d7l A:62-315)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534714Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2534738Protein automated matches [310868] (6 species)
    not a true protein
  7. 2534758Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (32 PDB entries)
  8. 2534774Domain d7d7la2: 7d7l A:62-315 [403209]
    Other proteins in same PDB: d7d7la1, d7d7lb1
    automated match to d4m0wa2
    complexed with cff, gol, gxu, so4, zn

Details for d7d7la2

PDB Entry: 7d7l (more details), 2.11 Å

PDB Description: the crystal structure of sars-cov-2 papain-like protease in complex with ym155
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d7d7la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d7la2 d.3.1.23 (A:62-315) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnnsylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensytttik

SCOPe Domain Coordinates for d7d7la2:

Click to download the PDB-style file with coordinates for d7d7la2.
(The format of our PDB-style files is described here.)

Timeline for d7d7la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7d7la1