Lineage for d4aig__ (4aig -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) 
Family d.92.1.9: Hemorrhagin [55519] (1 protein) Protein Snake venom metalloprotease [55520] (4 species) 
Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries) 
Domain d4aig__: 4aig - [40318]
Details for d4aig__
PDB Entry: 4aig (more details), 2 Å
PDB Description: adamalysin ii with phosphonate inhibitor
SCOP Domain Sequences for d4aig__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp
SCOP Domain Coordinates for d4aig__:
Click to download the PDB-style file with coordinates for d4aig__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4aig__:
- d4aig__ first appeared (with stable ids) in SCOP 1.55
- d4aig__ appears in SCOP 1.59
- d4aig__ appears in the current release, SCOPe 2.08, called d4aiga_
View in 3D