Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) |
Family d.92.1.9: Hemorrhagin [55519] (1 protein) |
Protein Snake venom metalloprotease [55520] (4 species) |
Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries) |
Domain d4aig__: 4aig - [40318] |
PDB Entry: 4aig (more details), 2 Å
SCOP Domain Sequences for d4aig__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II} nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd smgyyqkflnqykpqcilnkp
Timeline for d4aig__: