SCOPe 2.07: Domain d7coul_: 7cou L:

Lineage for d7coul_ (7cou L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)

8. Domain d7coul_: 7cou L: [403167]
   Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7coui_, d7couj_, d7couk_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
   automated match to d3a0hl_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7coul_

PDB Entry: 7cou, 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d7coul_:

Sequence; same for both SEQRES and ATOM records:

>d7coul_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
epnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d7coul_:

• d7coul_ is new in SCOPe 2.07-stable
  
• d7coul_ appears in the current release, SCOPe 2.08