SCOPe 2.07: Domain d7cc3a_: 7cc3 A:

Lineage for d7cc3a_ (7cc3 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (12 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [403038] (5 PDB entries)

8. Domain d7cc3a_: 7cc3 A: [403162]
   automated match to d5hxpa_
   complexed with dpo, fq0, fqf, fv3, po4

Details for d7cc3a_

PDB Entry: 7cc3, 1.72 Å

PDB Description: versatile cis-prenyltransferase mm_0014 from methanosarcina mazei (crystal type: co-fg)

PDB Compounds: (A:) cis-prenyltransferase MM_0014

SCOPe Domain Sequences for d7cc3a_:

Sequence, based on SEQRES records:

>d7cc3a_ c.101.1.0 (A:) automated matches {Methanosarcina mazei [TaxId: 192952]}
pgyqmdipkfkrlprhiaiipdgnrrwalarglekhegyssgiipglevydicvkigige
vtffgftqdntkrpqiqrkaftdaciksvqeiakrdaeilvvgntnsdifpeelleytkr
tkvgkgkikinflinygwywdltyaydnspdgkkmieniasaeiprvdllirwggrcrls
gmlpvqtvysdiyvvdemwpdfkpehlfkalefyqnqd

Sequence, based on observed residues (ATOM records):

>d7cc3a_ c.101.1.0 (A:) automated matches {Methanosarcina mazei [TaxId: 192952]}
pgyqmdipkfkrlprhiaiipdgnrrwalarglekhegyssgiipglevydicvkigige
vtffgftqdntkrpqiqrkaftdaciksvqeiakrdaeilvvgntnsdifpeelleytkr
tkvgkgkikinflinygwywdltyaykmieniasaeiprvdllirwggrcrlsgmlpvqt
vysdiyvvdemwpdfkpehlfkalefyqnqd

Timeline for d7cc3a_:

• d7cc3a_ is new in SCOPe 2.07-stable
  
• d7cc3a_ appears in the current release, SCOPe 2.08, called d7cc3a1