SCOP 1.59: Domain d1iac__: 1iac -

Lineage for d1iac__ (1iac -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.8: Astacin [55516] (1 protein)

6. Protein Astacin [55517] (1 species)

7. Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [55518] (8 PDB entries)

8. Domain d1iac__: 1iac - [40316]

Details for d1iac__

PDB Entry: 1iac, 2.1 Å

PDB Description: refined 1.8 angstroms x-ray crystal structure of astacin, a zinc-endopeptidase from the crayfish astacus astacus l. structure determination, refinement, molecular structure and comparison with thermolysin

SCOP Domain Sequences for d1iac__:

Sequence; same for both SEQRES and ATOM records:

>d1iac__ d.92.1.8 (-) Astacin {European fresh water crayfish (Astacus astacus)}
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecsl

Timeline for d1iac__:

• d1iac__ first appeared (with stable ids) in SCOP 1.55
  
• d1iac__ appears in SCOP 1.57
  
• d1iac__ appears in SCOP 1.61
  
• d1iac__ appears in the current release, SCOPe 2.08, called d1iaca_