Lineage for d7coum_ (7cou m:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631923Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2631924Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2631925Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 2631938Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)
  8. 2631944Domain d7coum_: 7cou m: [403135]
    Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7coui_, d7couj_, d7couk_, d7coul_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7coum_

PDB Entry: 7cou (more details), 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state
PDB Compounds: (m:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d7coum_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7coum_ f.23.35.1 (m:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d7coum_:

Click to download the PDB-style file with coordinates for d7coum_.
(The format of our PDB-style files is described here.)

Timeline for d7coum_: