Lineage for d7couk_ (7cou K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631976Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2631977Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 2631978Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 2631985Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (25 PDB entries)
  8. 2631993Domain d7couk_: 7cou K: [403129]
    Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7coui_, d7couj_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
    automated match to d2axtk1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7couk_

PDB Entry: 7cou (more details), 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d7couk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7couk_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d7couk_:

Click to download the PDB-style file with coordinates for d7couk_.
(The format of our PDB-style files is described here.)

Timeline for d7couk_: