Lineage for d7coui_ (7cou i:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632032Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2632033Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2632034Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2632048Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 2632054Domain d7coui_: 7cou i: [403127]
    Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7couj_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7coui_

PDB Entry: 7cou (more details), 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state
PDB Compounds: (i:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d7coui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7coui_ f.23.37.1 (i:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d7coui_:

Click to download the PDB-style file with coordinates for d7coui_.
(The format of our PDB-style files is described here.)

Timeline for d7coui_: