Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries) |
Domain d7cjjb_: 7cjj b: [403122] Other proteins in same PDB: d7cjja_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_ automated match to d4il6b_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cjj (more details), 2.4 Å
SCOPe Domain Sequences for d7cjjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjjb_ f.55.1.1 (b:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg idpelspeqvewgfyqkvgdvttr
Timeline for d7cjjb_: