Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Pseudomonas sp. [TaxId:306] [403041] (1 PDB entry) |
Domain d7bzvb1: 7bzv B:1-489 [403112] Other proteins in same PDB: d7bzva2, d7bzvb2 automated match to d5ac0a_ complexed with gol, peg, so4 |
PDB Entry: 7bzv (more details), 1.99 Å
SCOPe Domain Sequences for d7bzvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bzvb1 c.82.1.0 (B:1-489) automated matches {Pseudomonas sp. [TaxId: 306]} mkqyrnfvdgkwvessktfqdvtpidgsvvavvheadrdlvdaavkaghralegewgrtt aaqrvdwlrrianemerrqqdfldaemadtgkplsmaatidiprgianfrnfadilatap vdshrldlpdgayalnyaarkplgvvgvispwnlplllltwkvapalacgnavvvkpsed tpgtatllaevmeavgippgvfnlvhgfgpnsagefisqhpdisaitftgesktgstimr aaaegvkpvsfelggknaavifadcdfekmldgmmralflnsgqvclcservyverpifd rfcvalaerikalkvdwphetdtqmgplisskhrdkvlsyfelarqegatflagggvprf gderdngawveptviaglsddarvvreeifgpichvtpfdsesevirrandtryglaati wttnlsrahrvselmrvgiswvntwflrdlrtpfggaglsgigreggmhslnfyseltnv cvridkesp
Timeline for d7bzvb1: