Lineage for d1asta_ (1ast A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729283Family d.92.1.8: Astacin [55516] (1 protein)
  6. 729284Protein Astacin [55517] (1 species)
  7. 729285Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [55518] (8 PDB entries)
  8. 729287Domain d1asta_: 1ast A: [40310]
    complexed with zn

Details for d1asta_

PDB Entry: 1ast (more details), 1.8 Å

PDB Description: structure of astacin and implications for activation of astacins and zinc-ligation of collagenases
PDB Compounds: (A:) astacin

SCOP Domain Sequences for d1asta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]}
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecsl

SCOP Domain Coordinates for d1asta_:

Click to download the PDB-style file with coordinates for d1asta_.
(The format of our PDB-style files is described here.)

Timeline for d1asta_: