![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
![]() | Family d.92.1.8: Astacin [55516] (1 protein) |
![]() | Protein Astacin [55517] (1 species) |
![]() | Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [55518] (8 PDB entries) |
![]() | Domain d1ast__: 1ast - [40310] complexed with zn |
PDB Entry: 1ast (more details), 1.8 Å
SCOP Domain Sequences for d1ast__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ast__ d.92.1.8 (-) Astacin {European fresh water crayfish (Astacus astacus)} aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka hmlqtdanqinnlytnecsl
Timeline for d1ast__: