Lineage for d1ast__ (1ast -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 260053Family d.92.1.8: Astacin [55516] (1 protein)
  6. 260054Protein Astacin [55517] (1 species)
  7. 260055Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [55518] (8 PDB entries)
  8. 260056Domain d1ast__: 1ast - [40310]
    complexed with zn

Details for d1ast__

PDB Entry: 1ast (more details), 1.8 Å

PDB Description: structure of astacin and implications for activation of astacins and zinc-ligation of collagenases

SCOP Domain Sequences for d1ast__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ast__ d.92.1.8 (-) Astacin {European fresh water crayfish (Astacus astacus)}
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecsl

SCOP Domain Coordinates for d1ast__:

Click to download the PDB-style file with coordinates for d1ast__.
(The format of our PDB-style files is described here.)

Timeline for d1ast__: