Lineage for d7cjje_ (7cjj E:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026746Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. 3026755Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (22 PDB entries)
  8. 3026773Domain d7cjje_: 7cjj E: [403082]
    Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_
    automated match to d2axte1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

    has additional insertions and/or extensions that are not grouped together

Details for d7cjje_

PDB Entry: 7cjj (more details), 2.4 Å

PDB Description: photosystem ii structure in the s2 state
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d7cjje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjje_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d7cjje_:

Click to download the PDB-style file with coordinates for d7cjje_.
(The format of our PDB-style files is described here.)

Timeline for d7cjje_: