Lineage for d1f31a3 (1f31 A:1-533)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205348Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2205349Protein Botulinum neurotoxin [55513] (4 species)
  7. 2205385Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (17 PDB entries)
  8. 2205400Domain d1f31a3: 1f31 A:1-533 [40308]
    Other proteins in same PDB: d1f31a1, d1f31a2, d1f31a4
    complexed with so4, zn

Details for d1f31a3

PDB Entry: 1f31 (more details), 2.6 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with a trisaccharide
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1f31a3:

Sequence, based on SEQRES records: (download)

>d1f31a3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1f31a3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqeasifnrrgyfsdpalilmhelihvlhglygikv
ddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivdrln
kvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetniaen
ykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqayeei
skehlavykiqmcksgicidvdnedlffiadknsfsddlsknerieyntqsnyiendfpi
nelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOPe Domain Coordinates for d1f31a3:

Click to download the PDB-style file with coordinates for d1f31a3.
(The format of our PDB-style files is described here.)

Timeline for d1f31a3: