Lineage for d1f31a3 (1f31 A:1-533)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34380Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 34381Protein Botulinum neurotoxin [55513] (2 species)
  7. 34384Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (5 PDB entries)
  8. 34388Domain d1f31a3: 1f31 A:1-533 [40308]
    Other proteins in same PDB: d1f31a1, d1f31a2, d1f31a4

Details for d1f31a3

PDB Entry: 1f31 (more details), 2.6 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with a trisaccharide
PDB Compounds: (A:)

SCOP Domain Sequences for d1f31a3:

Sequence, based on SEQRES records: (download)

>d1f31a3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1f31a3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqeasifnrrgyfsdpalilmhelihvlhglygikv
ddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivdrln
kvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetniaen
ykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqayeei
skehlavykiqmcksgicidvdnedlffiadknsfsddlsknerieyntqsnyiendfpi
nelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOP Domain Coordinates for d1f31a3:

Click to download the PDB-style file with coordinates for d1f31a3.
(The format of our PDB-style files is described here.)

Timeline for d1f31a3: