Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d7c88b2: 7c88 B:129-234 [403063] Other proteins in same PDB: d7c88b1, d7c88c_, d7c88l1, d7c88m_ automated match to d1dn0a2 |
PDB Entry: 7c88 (more details), 2 Å
SCOPe Domain Sequences for d7c88b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c88b2 b.1.1.2 (B:129-234) automated matches {Mouse (Mus musculus) [TaxId: 10090]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d7c88b2:
View in 3D Domains from other chains: (mouse over for more information) d7c88c_, d7c88l1, d7c88l2, d7c88m_ |