SCOPe 2.07: Domain d7casa_: 7cas A:

Lineage for d7casa_ (7cas A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (12 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [403038] (5 PDB entries)

8. Domain d7casa_: 7cas A: [403054]
   automated match to d5hxpa_
   complexed with dpo, mg, plm, po4

Details for d7casa_

PDB Entry: 7cas, 2.28 Å

PDB Description: versatile cis-prenyltransferase mm_0014 from methanosarcina mazei (crystal type: free+ppi)

PDB Compounds: (A:) cis-prenyltransferase MM_0014

SCOPe Domain Sequences for d7casa_:

Sequence; same for both SEQRES and ATOM records:

>d7casa_ c.101.1.0 (A:) automated matches {Methanosarcina mazei [TaxId: 192952]}
fkrlprhiaiipdgnrrwalarglekhegyssgiipglevydicvkigigevtffgftqd
ntkrpqiqrkaftdaciksvqeiakrdaeilvvgntnsdifpeelleytkrtkvgkgkik
inflinygwywdltyaydnspdgkkmieniasaeiprvdllirwggrcrlsgmlpvqtvy
sdiyvvdemwpdfkpehlfkalefyqnqditlgg

Timeline for d7casa_:

• d7casa_ is new in SCOPe 2.07-stable
  
• d7casa_ appears in the current release, SCOPe 2.08