Lineage for d1smpa2 (1smp A:4-246)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034635Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 1034636Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 1034656Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
    Serralysin
  8. 1034660Domain d1smpa2: 1smp A:4-246 [40303]
    Other proteins in same PDB: d1smpa1, d1smpi_
    complexed with ca, zn

Details for d1smpa2

PDB Entry: 1smp (more details), 2.3 Å

PDB Description: crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi
PDB Compounds: (A:) serratia metallo proteinase

SCOPe Domain Sequences for d1smpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smpa2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegnptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

SCOPe Domain Coordinates for d1smpa2:

Click to download the PDB-style file with coordinates for d1smpa2.
(The format of our PDB-style files is described here.)

Timeline for d1smpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1smpa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1smpi_