Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries) Serralysin |
Domain d1smpa2: 1smp A:4-246 [40303] Other proteins in same PDB: d1smpa1, d1smpi_ complexed with ca, zn |
PDB Entry: 1smp (more details), 2.3 Å
SCOP Domain Sequences for d1smpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smpa2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens} tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg lshpgdynagegnptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq hly
Timeline for d1smpa2: