| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
| Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
| Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
| Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries) Serralysin |
| Domain d1srp_2: 1srp 4-246 [40302] Other proteins in same PDB: d1srp_1 complexed with ca, zn |
PDB Entry: 1srp (more details), 2 Å
SCOP Domain Sequences for d1srp_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1srp_2 d.92.1.6 (4-246) Metalloprotease {Serratia marcescens}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegnptyrdvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly
Timeline for d1srp_2: