Lineage for d1srp_2 (1srp 4-246)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 260019Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 260020Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 260034Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
    Serralysin
  8. 260037Domain d1srp_2: 1srp 4-246 [40302]
    Other proteins in same PDB: d1srp_1
    complexed with ca, zn

Details for d1srp_2

PDB Entry: 1srp (more details), 2 Å

PDB Description: structural analysis of serratia protease

SCOP Domain Sequences for d1srp_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srp_2 d.92.1.6 (4-246) Metalloprotease {Serratia marcescens}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegnptyrdvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

SCOP Domain Coordinates for d1srp_2:

Click to download the PDB-style file with coordinates for d1srp_2.
(The format of our PDB-style files is described here.)

Timeline for d1srp_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1srp_1