SCOP 1.63: Domain d1srp_2: 1srp 4-246

Lineage for d1srp_2 (1srp 4-246)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
   Serralysin

8. Domain d1srp_2: 1srp 4-246 [40302]
   Other proteins in same PDB: d1srp_1
   complexed with ca, zn

Details for d1srp_2

PDB Entry: 1srp, 2 Å

PDB Description: structural analysis of serratia protease

SCOP Domain Sequences for d1srp_2:

Sequence; same for both SEQRES and ATOM records:

>d1srp_2 d.92.1.6 (4-246) Metalloprotease {Serratia marcescens}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegnptyrdvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

Timeline for d1srp_2:

• d1srp_2 first appeared (with stable ids) in SCOP 1.55
  
• d1srp_2 appears in SCOP 1.61
  
• d1srp_2 appears in SCOP 1.65
  
• d1srp_2 appears in the current release, SCOPe 2.08, called d1srpa2