Lineage for d7bxrb_ (7bxr B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504654Species Cupriavidus necator [TaxId:106590] [403018] (4 PDB entries)
  8. 2504662Domain d7bxrb_: 7bxr B: [403019]
    automated match to d3tqxa_
    complexed with f9x

Details for d7bxrb_

PDB Entry: 7bxr (more details), 2.55 Å

PDB Description: 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
PDB Compounds: (B:) 2-amino-3-ketobutyrate coenzyme A ligase

SCOPe Domain Sequences for d7bxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bxrb_ c.67.1.0 (B:) automated matches {Cupriavidus necator [TaxId: 106590]}
msnaeafyasirtelesiraaglfknerviatpqgarvrttdgrevinlcannylglssh
pqvieaahealrthgfglssvrficgtqdlhktlearlsaflgtedtilygsafdanggl
fetllgaedavisdalnhasiidgvrlskarryryqhndmddlrvqleqaradgarytlv
fsdgvfsmdgtvarldemraicdeygallgidechatgfmgqrgrgtheargvfgkidii
tgtlgaalggasggftsarkevvallrqrsrpylfsntvapaivgasiavldileastel
rdrlegntrffragldrlgfdvkagdhpiipimvydadkaqqlaqrllelgvyvvgffyp
vvpkgqarirvqmsalhdeaalqaaldafgqagrelgli

SCOPe Domain Coordinates for d7bxrb_:

Click to download the PDB-style file with coordinates for d7bxrb_.
(The format of our PDB-style files is described here.)

Timeline for d7bxrb_: