Lineage for d7bfld_ (7bfl D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928655Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 2928656Protein automated matches [190767] (7 species)
    not a true protein
  7. 2928657Species Atlantic salmon (Salmo salar) [TaxId:8030] [402957] (2 PDB entries)
  8. 2928663Domain d7bfld_: 7bfl D: [403010]
    automated match to d2vq9a_

Details for d7bfld_

PDB Entry: 7bfl (more details), 2.88 Å

PDB Description: x-ray structure of ss-rnase-2 des116-120
PDB Compounds: (D:) Angiogenin-1

SCOPe Domain Sequences for d7bfld_:

Sequence, based on SEQRES records: (download)

>d7bfld_ d.5.1.0 (D:) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]}
nqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictgggt
lkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgi

Sequence, based on observed residues (ATOM records): (download)

>d7bfld_ d.5.1.0 (D:) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]}
nqqynhflkqhvdgemttlkcksqmeilnlrkcklkntfilanpdqvqaictgggtlkgn
nlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgi

SCOPe Domain Coordinates for d7bfld_:

Click to download the PDB-style file with coordinates for d7bfld_.
(The format of our PDB-style files is described here.)

Timeline for d7bfld_: