Lineage for d1af0a2 (1af0 A:2-246)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1660899Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 1660900Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 1660924Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
    Serralysin
  8. 1660926Domain d1af0a2: 1af0 A:2-246 [40301]
    Other proteins in same PDB: d1af0a1
    complexed with 0z9, ca, zn

Details for d1af0a2

PDB Entry: 1af0 (more details), 1.8 Å

PDB Description: serratia protease in complex with inhibitor
PDB Compounds: (A:) serratia protease

SCOPe Domain Sequences for d1af0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1af0a2 d.92.1.6 (A:2-246) Metalloprotease {Serratia marcescens [TaxId: 615]}
attgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfs
fpdykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnys
qdrpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheigha
lglshpgdynagegdptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaa
iqhly

SCOPe Domain Coordinates for d1af0a2:

Click to download the PDB-style file with coordinates for d1af0a2.
(The format of our PDB-style files is described here.)

Timeline for d1af0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1af0a1