Lineage for d1af0a2 (1af0 A:2-246)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein) Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species) 
Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries) 
Domain d1af0a2: 1af0 A:2-246 [40301]
Other proteins in same PDB: d1af0a1
Details for d1af0a2
PDB Entry: 1af0 (more details), 1.8 Å
PDB Description: serratia protease in complex with inhibitor
SCOP Domain Sequences for d1af0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1af0a2 d.92.1.6 (A:2-246) Metallo protease, catalytic (N-terminal) domain {Serratia marcescens}
attgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfs
fpdykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnys
qdrpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheigha
lglshpgdynagegdptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaa
iqhly
SCOP Domain Coordinates for d1af0a2:
Click to download the PDB-style file with coordinates for d1af0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1af0a2:
- d1af0a2 first appeared (with stable ids) in SCOP 1.55
- d1af0a2 appears in SCOP 1.59
- d1af0a2 appears in SCOP 1.63
- d1af0a2 appears in the current release, SCOPe 2.08
View in 3D
