Lineage for d1af0a2 (1af0 A:2-246)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34370Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein)
  6. 34371Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species)
  7. 34375Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
  8. 34377Domain d1af0a2: 1af0 A:2-246 [40301]
    Other proteins in same PDB: d1af0a1

Details for d1af0a2

PDB Entry: 1af0 (more details), 1.8 Å

PDB Description: serratia protease in complex with inhibitor

SCOP Domain Sequences for d1af0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1af0a2 d.92.1.6 (A:2-246) Metallo protease, catalytic (N-terminal) domain {Serratia marcescens}
attgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfs
fpdykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnys
qdrpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheigha
lglshpgdynagegdptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaa
iqhly

SCOP Domain Coordinates for d1af0a2:

Click to download the PDB-style file with coordinates for d1af0a2.
(The format of our PDB-style files is described here.)

Timeline for d1af0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1af0a1